.
The Open Protein Structure Annotation Network
PDB Keyword
.

1g8a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Structural Approach to Gene Function and Structure Quality for Pyrococcus horikoshii Fibrillarin. To be Published
    Site BSGC
    PDB Id 1g8a Target Id BSGCAIR30655
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS8714, Molecular Weight 25826.44 Da.
    Residues 227 Isoelectric Point 6.38
    Sequence mvevkkhkfpgvytvidddgseriatknlvpgqrvygervikwegeeyriwnpnrsklgaaimnglknf pikpgksvlylgiasgttashvsdivgwegkifgiefsprvlrelvpiveerrnivpilgdatkpeeyr alvpkvdvifedvaqptqakilidnaevylkrggygmiavksrsidvtkepeqvfreverelseyfevi erlnlepyekdhalfvvrkt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.218
    Matthews' coefficent 1.97 Rfactor 0.203
    Waters 407 Solvent Content 37.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1g8a

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch