.
The Open Protein Structure Annotation Network
PDB Keyword
.

1g2i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an intracellular protease from Pyrococcus horikoshii at 2-A resolution. Proc.Natl.Acad.Sci.USA 97 14079-14084 2000
    Site BSGC
    PDB Id 1g2i Target Id BSGCAIR30332
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS8324, Molecular Weight 18623.47 Da.
    Residues 166 Isoelectric Point 6.11
    Sequence mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpeefdalvlpg grapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsypgikddminagvewvdae vvvdgnwvssrvpadlyawmrefvkllk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.2
    Matthews' coefficent 4.43 Rfactor 0.184
    Waters 277 Solvent Content 72.27

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1g2i

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch