.
The Open Protein Structure Annotation Network
PDB Keyword
.

1f5s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphoserine phosphatase from Methanococcus jannaschii, a hyperthermophile, at 1.8 A resolution. Structure 9 65-72 2001
    Site BSGC
    PDB Id 1f5s Target Id BSGCAIR30380
    Related PDB Ids 1j97 1l7m 1l7n 1l7o 1l7p 
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8363, Molecular Weight 23592.31 Da.
    Residues 211 Isoelectric Point 7.60
    Sequence mekkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllkdlpiekve kaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafanrlivkdgkltgdvegev lkenakgeilekiakieginledtvavgdgandismfkkaglkiafcakpilkekadiciekrdlreil kyik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.235
    Matthews' coefficent 2.33 Rfactor 0.198
    Waters 383 Solvent Content 47.20

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 1f5s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch