.
The Open Protein Structure Annotation Network
PDB Keyword
.

1dus

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure-based experimental confirmation of biochemical function to a methyltransferase, MJ0882, from hyperthermophile Methanococcus jannaschii. J.STRUCT.FUNCT.GENOM. 2 121-127 2002
    Site BSGC
    PDB Id 1dus Target Id BSGCAIR30382
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8510, Molecular Weight 22242.70 Da.
    Residues 197 Isoelectric Point 9.31
    Sequence mhyfsekpttksdvkivedilrgkklkfktdsgvfsygkvdkgtkilvenvvvdkdddildlgcgygvi gialadevksttmadinrraiklakeniklnnldnydirvvhsdlyenvkdrkynkiitnppiragkev lhriieegkellkdngeiwvviqtkqgakslakymkdvfgnvetvtikggyrvlkskkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.235
    Matthews' coefficent 1.99 Rfactor 0.188
    Waters 163 Solvent Content 38.05

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1dus

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch