The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Yahk, a Zinc-Type Alcohol Dehydrogenase-Like Protein. To be Published
    Site BIGS
    PDB Id 1uuf Target Id ASG-yahK
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS11898, Molecular Weight 37976.39 Da.
    Residues 349 Isoelectric Point 5.80
    Sequence mkikavgaysakqplepmditrrepgpndvkieiaycgvchsdlhqvrsewagtvypcvpgheivgrvv avgdqvekyapgdlvgvgcivdsckhceecedglenycdhmtgtynsptpdepghtlggysqqivvher yvlrirhpqeqlaavapllcagittysplrhwqagpgkkvgvvgigglghmgiklahamgahvvaftts eakreaakalgadevvnsrnademaahlksfdfilntvaaphnlddfttllkrdgtmtlvgapatphks pevfnlimkrraiagsmiggipetqemldfcaehgivadiemiradqineayermlrgdvkyrfvidnrtltd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.208
    Matthews' coefficent 2.25 Rfactor 0.184
    Waters 375 Solvent Content 45

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1uuf

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch