.
The Open Protein Structure Annotation Network
PDB Keyword
.

1okj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title MAD Crystal Structure of the Unknown Function E. Coli Yeaz Protein. To be Published
    Site BIGS
    PDB Id 1okj Target Id IGS-yeaZ
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS11906, Molecular Weight 25179.50 Da.
    Residues 231 Isoelectric Point 5.02
    Sequence mrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinalaygrgpgsft gvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidarmgevywaeyqrdengiwhge eteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesglvlrdgevllpaaedmlpiacqmfaegkt vavehaepvylrnnvawkklpgke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.28 Rfree 0.257
    Matthews' coefficent 2.36 Rfactor 0.216
    Waters 303 Solvent Content 47.9

    Ligand Information
    Ligands
    Metals GD3 (GADOLINIUM) x 8

    Jmol

     
    Google Scholar output for 1okj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch