.
The Open Protein Structure Annotation Network
PDB Keyword
.

1oi4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Yhbo from Escherichia Coli. To be Published
    Site BIGS
    PDB Id 1oi4 Target Id ASG-yhbO
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS11902, Molecular Weight 18857.39 Da.
    Residues 172 Isoelectric Point 5.27
    Sequence mskkiavlitdefedseftspadefrkaghevitiekqagktvkgkkgeasvtidksidevtpaefdal llpgghspdylrgdnrfvtftrdfvnsgkpvfaichgpqllisadvirgrkltavkpiiidvknagaef ydqevvvdkdqlvtsrtpddlpafnrealrllga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.03 Rfree 0.237
    Matthews' coefficent 2.24 Rfactor 0.187
    Waters 404 Solvent Content 45.12

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1oi4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch