.
The Open Protein Structure Annotation Network
PDB Keyword
.

1og6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Ydhf, an Aldo-Keto Reductase from Escherichia Coli. To be Published
    Site BIGS
    PDB Id 1og6 Target Id ASG-ydhF
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS11900, Molecular Weight 33624.79 Da.
    Residues 298 Isoelectric Point 5.77
    Sequence mvqritiapqgpefsrfvmgywrlmdwnmsarqlvsfieehldlgvttvdhadiyggyqceaafgealk laphlrermeivskcgiattareenvighyitdrdhiiksaeqslinlatdhldlllihrpdplmdade vadafkhlhqsgkvrhfgvsnftpaqfallqsrlpftlatnqveispvhqpllldgtldqlqqlrvrpm awsclgggrlfnddyfqplrdelavvaeelnagsieqvvnawvlrlpsqplpiigsgkiervraaveae tlkmtrqqwfrirkaalgydvp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.8 Rfree 0.238
    Matthews' coefficent 2.93 Rfactor 0.207
    Waters 199 Solvent Content 58

    Ligand Information
    Ligands NAP (NADP) x 3
    Metals

    Jmol

     
    Google Scholar output for 1og6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch