.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mzr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Escherichia coli DkgA, a broad-specificity aldo-keto reductase. Proteins 62 302-307 2006
    Site BIGS
    PDB Id 1mzr Target Id ASG-yqhE
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS11904, Molecular Weight 31108.07 Da.
    Residues 275 Isoelectric Point 6.00
    Sequence manptviklqdgnvmpqlglgvwqasneevitaiqkalevgyrsidtaaaykneegvgkalknasvnre elfittklwnddhkrprealldslkklqldyidlylmhwpvpaidhyveawkgmielqkegliksigvc nfqihhlqrlidetgvtpvinqielhplmqqrqlhawnathkiqteswsplaqggkgvfdqkvirdlad kygktpaqivirwhldsglvvipksvtpsriaenfdvwdfrldkdelgeiakldqgkrlgpdpdqfgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.13 Rfree 0.22
    Matthews' coefficent 2.99 Rfactor 0.175
    Waters 583 Solvent Content 58.87

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 5;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 1mzr

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch