.
The Open Protein Structure Annotation Network
PDB Keyword
.

1gpq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and Evolution of a Paradoxical Protein Family of Vertebrate Lysozyme Inhibitors Only Found in Gram-Negative Bacteria. To be Published
    Site BIGS
    PDB Id 1gpq Target Id ORPH-ykfE
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS11905, Molecular Weight 16871.41 Da.
    Residues 157 Isoelectric Point 6.27
    Sequence mgrissggmmfkaittvaalviatsamaqddltisslakgettkaafnqmvqghklpawvmkggtytpa qtvtlgdetyqvmsackphdcgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktv lfaaltgslenhpdgfnfk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.6 Rfree 0.212
    Matthews' coefficent 1.98 Rfactor 0.181
    Waters 635 Solvent Content 38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1gpq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch