.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eml

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2.6 Angstrom Crystal Structure of a Human A2A Adenosine Receptor Bound to an Antagonist. Science 322 1211-1217 2008
    Site ATCG3D
    PDB Id 3eml Target Id ATCG3D_5
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS21045,NP_000666 Molecular Weight 46248.47 Da.
    Residues 407 Isoelectric Point 6.78
    Sequence mdnvlpvdsdlspnistntsepnqfvqpawqivlwaaaytvivvtsvvgnvvvmwiilahkrmrtvtny flvnlafaeasmaafntvvnftyavhnewyyglfyckfhnffpiaavfasiysmtavafdrymaiihpl qprlsatatkvvicviwvlalllafpqgyysttetmpsrvvcmiewpehpnkiyekvyhicvtvliyfl pllvigyaytvvgitlwaseipgdssdryheqvsakrkvvkmmivvvctfaicwlpfhiffllpyinpd lylkkfiqqvylaimwlamsstmynpiiycclndrfrlgfkhafrccpfisagdyeglemkstrylqtq gsvykvsrlettistvvgaheeepedgpkatpssldltsncssrsdsktmtesfsfssnvls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.231
    Matthews' coefficent 2.85 Rfactor 0.196
    Waters 76 Solvent Content 56.79

    Ligand Information
    Ligands ZMA (4-{2-[(7-AMINO-2-FURAN-2-YL[1,2,4]TRIAZOLO[1,5-A][1,3,) x 1;STE (STEARIC) x 5;SO4 (SULFATE) x 7
    Metals

    Jmol

     
    Google Scholar output for 3eml

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch