The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Methionine-R-sulfoxide reductase from Burkholderia pseudomallei. To be Published
    Site ATCG3D
    PDB Id 3cez Target Id ATCG3D_20
    Molecular Characteristics
    Source Burkholderia pseudomallei
    Alias Ids TPS11897,YP_333853 Molecular Weight 16186.16 Da.
    Residues 143 Isoelectric Point 5.31
    Sequence msgdrddprypypkddaelrrrltpmqyevtqhaateppftgeytdtedagiyhcvvcgtalfesgaky hsgcgwpsyfkpidgevidekmdythgmtrvevrcnqcgahlghvfedgprdktglrycinsaalnfea kperk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.23367
    Matthews' coefficent 2.22 Rfactor 0.17612
    Waters 223 Solvent Content 44.53

    Ligand Information
    Ligands ACY (ACETIC) x 2
    Metals ZN (ZINC) x 2


    Google Scholar output for 3cez

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch