.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rh1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title High-resolution crystal structure of an engineered human beta2-adrenergic G protein-coupled receptor. Science 318 1258-1265 2007
    Site ATCG3D
    PDB Id 2rh1 Target Id ATCG3D_17
    Molecular Characteristics
    Source Bacteriophage t4
    Alias Ids TPS11894,P07550 Molecular Weight 56539.67 Da.
    Residues 500 Isoelectric Point 8.81
    Sequence dykdddamgqpgngsafllapnrshapdhdvtqqrdevwvvgmgivmslivlaivfgnvlvitaiakfe rlqtvtnyfitslacadlvmglavvpfgaahilmkmwtfgnfwcefwtsidvlcvtasietlcviavdr yfaitspfkyqslltknkarviilmvwivsgltsflpiqmhwyrathqeaincyaeetccdfftnqaya iassivsfyvplvimvfvysrvfqeakrqlnifemlrideglrlkiykdtegyytigighlltkspsln aakseldkaigrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmget gvagftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdaykfclkehkalktlgiim gtftlcwlpffivnivhviqdnlirkevyillnwigyvnsgfnpliycrspdfriafqellclrrsslk aygngyssngntgeqsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.232
    Matthews' coefficent 3.07 Rfactor 0.196
    Waters 48 Solvent Content 59.98

    Ligand Information
    Ligands MAL (MALTOSE) x 1;SO4 (SULFATE) x 6;CAU ((2S)-1-(9H-CARBAZOL-4-YLOXY)-3-(ISOPROPYLAMINO)PROPAN-) x 1;BU1 (1,4-BUTANEDIOL) x 2;ACM (ACETAMIDE) x 1;CLR (CHOLESTEROL) x 3;PLM (PALMITIC) x 1;12P (DODECAETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2rh1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch