The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional structure of the EphB2 receptor in complex with an antagonistic peptide reveals a novel mode of inhibition. J.Biol.Chem. 282 36505-36513 2007
    Site ATCG3D
    PDB Id 2qbx Target Id ATCG3D_15
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS11892,CAI22647 Molecular Weight 20223.71 Da.
    Residues 176 Isoelectric Point 5.42
    Sequence eetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfirrrgahrihv emkfsvrdcssipsvpgscketfnlyyyeadfdsatktfpnwmenpwvkvdtiaadesfsqvdlggrvm kintevrsfgpvsrsgfylafqdyggcmsliavrvfyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.2695
    Matthews' coefficent 2.18 Rfactor 0.19424
    Waters 174 Solvent Content 43.46

    Ligand Information


    Google Scholar output for 2qbx

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch