.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h1j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Time-Controlled Microfluidic Seeding in nL-Volume Droplets To Separate Nucleation and Growth Stages of Protein Crystallization. Angew.Chem.Int.Ed.Engl. 45 8156-8160 2006
    Site ATCG3D
    PDB Id 2h1j Target Id ATCG3D_19
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS11896,YP_146816.1 Molecular Weight 66251.10 Da.
    Residues 567 Isoelectric Point 5.33
    Sequence snamkfsefryerpdiaqlqasfqealdsfrragsaalqheamkrinelrrrystmanlchirhtidtn defykkeqdffdetepvvkglvndyyralvsspfraeleqvwgkqlfalaetqlktyapvivedlqken klaseytkliasakimfegeertlaqlqpfvespdramrqrasearfsffkdyekeldelydelvhvrt aiarklgfqnfvelgyarlgrtdynadmvagyrrqvkthivplaaklrerqrqriqveklyyydepfmf ptgnptpkgdadwivqngrqmyeelspetgeffrymvehelmdlvakkgkagggyctyiddykapfifs nftgtsgdidvltheaghafqvyesrhydipeynwptleaceihsmsmefftwpwmelffgedadkyrf ahlsdallflpygvavdefqhavyenpdmtpaerksvwrniekaylptrdyadhdylerggfwqrqghi ytdpfyyidytlaqvcafqfwkraqedrasawrdyvalcrlggsrpftelvksanlqspfadgavasvv ghierwldsvddkal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.10 Rfree 0.22529
    Matthews' coefficent 3.83 Rfactor 0.18735
    Waters 2 Solvent Content 67.87

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2h1j

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch