The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    No headers

    Site JCSG
    Status Crystallized
    Target Id 282160
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TM0284 Molecular Weight 56747.19 Da.
    Residues 506 Isoelectric Point 5.31
    Sequence myligsdigtqgtksvivnekgevlaeafreyevitpkpnwaeqwpdvwvkavfetvkevveksgvskke iagiaisglyggsgipvdrnmqplrpcliwmdrravketewvkqnvpkeklfeitgnyvdsyfgftkim wirnnepeiwekiykfitpkdyviyqmtgevvidyssagnlggvfdirkltwskemcdvlgipieflpe rivkssdvvgrvtkeaselcgllegtpvvaggidapvaqlsagaleegehvamvgtstcwgtvhdgskl afglvnypyvvydteriytfggsattgalarwfkeqfgesetivgertgispyqlfdkevanipagseg iivlpyfmgerspiwdptargvffgvtlyhkrahlyralmeggayalrhnmeeglkaglklndecwivg gvskssvwvkifadvtgfkmrqvaslveapygdaflaglgtgvidkperikewvkyrdpvepdpenkki ydryyeiyrelyertkdlmarl
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM0284
    generated 12/2008

    Structure Description




    Function Description




    Evolutionary Context Desciption




    Regulation Description








    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch